Transcript | Ll_transcript_72865 |
---|---|
CDS coordinates | 139-843 (+) |
Peptide sequence | MAVTMKNNVNKNNVSSTCLFCVPTLFLLFTLLSIFSISHLSSNPSFSLPSSSSSSSSSINVYVADLPRSLNYDLLHRYWSLNSDSRLPTDPDSEIRSTHISKTLDFPPYPESPLIKQYSAEYWIMGDLMTPPDLRTGSFSKRVFDARDADVVFVPFFATLSAELQLGMAKGVFRKKVGNDDYLRQREVMDFVKNTQAWKRSGGRDHVFVLTGKLSLSLFLFASATNLFLLRLYV* |
ORF Type | complete |
Blastp | Probable arabinosyltransferase ARAD1 from Arabidopsis with 26.67% of identity |
---|---|
Blastx | - |
Eggnog | Exostosin(ENOG410XTFH) |
Kegg | Link to kegg annotations (AT2G35100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453660.1) |
Pfam | Exostosin family (PF03016.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer