Protein coding transcript 208640

• Transcript: Ll_transcript_71374
• CDS coordinates: 115-528 (+)
• Peptide sequence: MVCLVSRTGRELQRYNSKGGRQVVGCIPYRYKKDIGGDKNNELEVLLVSSQKGQALMFPKGGWELDETIEEAACRESLEEAGVTGIIESELGQWSFISKRHGTYYEGHMLPLFVNEQLDMWPEKDLRRRVWMNIAEAR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_71374

• Blastp: Nudix hydrolase 17, mitochondrial from Arabidopsis with 65.94% of identity
• Blastx: Nudix hydrolase 17, mitochondrial from Arabidopsis with 65.25% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT2G01670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462060.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;