Protein coding transcript 208753

• Transcript: Ll_transcript_72256
• CDS coordinates: 463-801 (-)
• Peptide sequence: MCDHNTQRPRGFGFITYDSEDAVNRILYKTLIGYNFSWNRASSYINSYAQGLNMSPLGGYGVKMDGRFSPLSNGRSGLTKLVLVVMKHPIGICTTLYFLSEIKHIHIRLLKA*
• ORF Type: complete

Annotations of Ll_transcript_72256

• Blastp: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 61.29% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein 1 from Arabidopsis with 56.25% of identity
• Eggnog: Rna-binding protein(ENOG410YA8Z)
• Kegg: Link to kegg annotations (AT4G14300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456443.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;