Protein coding transcript 208780

• Transcript: Ll_transcript_73036
• CDS coordinates: 1210-1941 (+)
• Peptide sequence: MPFSVHNLTCSVCHSGICSVCFAQSIRGTRPFPWQRTDLFEDSLRAVGIPGIEVGTKLYVSNLDHGVTNEDIRELFSELGDLKRYAVHYDKNGRPSGSAEVVYTRRSDAFAALKRYNNVLLDGKPMKIENVGADAELPITARVNVTGVTGRRKRTVVMAPRSGGAVGPAAVPNRGLGWGRRGGPKVGSGGPRNWSGSGRGSGGGRGRGRGGGRGRGKKDGGEKSAEQLDKELETYHAEAMNIS*
• ORF Type: complete

Annotations of Ll_transcript_73036

• Blastp: THO complex subunit 4D from Arabidopsis with 51.88% of identity
• Blastx: THO complex subunit 4C from Arabidopsis with 62.24% of identity
• Eggnog: Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW)
• Kegg: Link to kegg annotations (AT5G37720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419488.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;