Protein coding transcript 208784

• Transcript: Ll_transcript_73050
• CDS coordinates: 906-1433 (+)
• Peptide sequence: MPFSVHNLTCSVCHSGICSVCFAQSIRGTRPFPWQRTDLFEDSLRAVGIPGIEVGTKLYVSNLDHGVTNEDIRELFSELGDLKRYAVHYDKNGRPSGSAEVVYTRRSDAFAALKRYNNVLLDGKPMKIENVGADAELPITARVNVTGVTGRRKRTVVMAPRSGGAVGPAAVPNRGL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_73050

• Blastp: THO complex subunit 4C from Arabidopsis with 62.24% of identity
• Blastx: THO complex subunit 4C from Arabidopsis with 62.24% of identity
• Eggnog: Polymerase (DNA-directed), delta interacting protein 3(ENOG4111JAW)
• Kegg: Link to kegg annotations (AT1G66260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419488.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;