Transcript | Ll_transcript_71892 |
---|---|
CDS coordinates | 363-965 (+) |
Peptide sequence | MILIQRSLSLFCLELLLAVAKALRRVAEGKASAQAEAAVWKHKYELERERHLQFENRGKSCPELQPDHDDMRTNNPVNQHTPCNETKERSERCCSRNGICSHEVLRDGSPGSDSKMIRKASFKLSWCCKGDQSDQQKHDIVSFERGNITTAQRSSKQISLKWESNPQTVLILTKPNSVSVQILCAEMIRCESHYIICFYF* |
ORF Type | complete |
Blastp | NAD(H) kinase 1 from Arabidopsis with 53.89% of identity |
---|---|
Blastx | NAD(H) kinase 1 from Arabidopsis with 82.52% of identity |
Eggnog | Catalyzes the phosphorylation of NAD to NADP. Utilizes ATP and other nucleoside triphosphates as well as inorganic polyphosphate as a source of phosphorus (By similarity)(COG0061) |
Kegg | Link to kegg annotations (AT3G21070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454316.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer