Protein coding transcript 208847

• Transcript: Ll_transcript_71173
• CDS coordinates: 136-873 (+)
• Peptide sequence: MAQLKALPSSYSYPATFPSVHRKEQLLHQQFWKANPSSFKELATRTTVETSKHQVIKAVVRSDAEVEISESKKGGGLRGKLNKVVLAYSGGLDTSVIVPWLRENYGCDVVCFTADVGQGIKELDGLEAKAKASGASQLVVKNLREEFVRDYIFPCLRAGAVYERKYLLGTSMAQPVIAKAMVDVAKEVGADAVSHGCTGKGNDQVPFELTFFALNPKLNVVAPWREWDITGMLLSMLKSIMYLFQ*
• ORF Type: complete

Annotations of Ll_transcript_71173

• Blastp: Argininosuccinate synthase, chloroplastic from Arabidopsis with 78.49% of identity
• Blastx: Argininosuccinate synthase, chloroplastic from Arabidopsis with 74.19% of identity
• Eggnog: Citrulline--aspartate ligase(COG0137)
• Kegg: Link to kegg annotations (AT4G24830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463071.1)
• Pfam: Arginosuccinate synthase (PF00764.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;