Transcript | Ll_transcript_71182 |
---|---|
CDS coordinates | 136-984 (+) |
Peptide sequence | MAQLKALPSSYSYPATFPSVHRKEQLLHQQFWKANPSSFKELATRTTVETSKHQVIKAVVRSDAEVEISESKKGGGLRGKLNKVVLAYSGGLDTSVIVPWLRENYGCDVVCFTADVGQGIKELDGLEAKAKASGASQLVVKDLREEFVKDYIFPCLRAGAVYERKYLLGTSMARPVIAKAMVDVAKEVGADAVSHGCTGKGNDQVRFELTFFALNPKLNVVAPWREWDITGREDAIEYAKKHNVPVPVTKKSIYSRDRNLWHLSHEVCFTTIFVLALVIVLS* |
ORF Type | complete |
Blastp | Argininosuccinate synthase, chloroplastic from Arabidopsis with 83.71% of identity |
---|---|
Blastx | Argininosuccinate synthase, chloroplastic from Arabidopsis with 80.09% of identity |
Eggnog | Citrulline--aspartate ligase(COG0137) |
Kegg | Link to kegg annotations (AT4G24830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463071.1) |
Pfam | Arginosuccinate synthase (PF00764.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer