Transcript | Ll_transcript_73098 |
---|---|
CDS coordinates | 167-904 (+) |
Peptide sequence | MSGEIAFDGQDAGYVPENVDFPQNDSDEHDEGNVIDDESGFPQQLDEHDAGILPEEETNPPENEFDGHGVEDLPGNSDTLPQEHIVTEEEHHDGGDMTENFTSQEVPEPEGDSKPTEIKRWPGWPGENVFRMLVPAQKVGSIIGRKGEFIKKITEETKARIKILDGPPGTTERAVSLLFNFLSFISENIVDIYTLFIEAYFPYFCSYTDPCAYLDALSVFRFKFCRVFSPLAVRLLSFLLSSLVY* |
ORF Type | complete |
Blastp | Flowering locus K homology domain from Arabidopsis with 71.95% of identity |
---|---|
Blastx | Flowering locus K homology domain from Arabidopsis with 51.05% of identity |
Eggnog | mRNA transport(ENOG410XNN8) |
Kegg | Link to kegg annotations (AT3G04610) |
CantataDB | Link to cantataDB annotations (CNT0002411) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428443.1) |
Pfam | KH domain (PF00013.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer