Protein coding transcript 20896

• Transcript: Ll_transcript_282677
• CDS coordinates: 166-1116 (+)
• Peptide sequence: MQEALTALHRYLPSNEADSHFDSEIPGRESDAPVDAYSCDQFRIYEFKIRKCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDFRKGSCKKGDACEHAHGVFECWLHPTRYRTQPCKDGTSCRRRVCFFAHTPEQLRIVPNHSPRSIDSYDGSPMRKGTMAFMSSPISISPPMSPPAESPPMSPMTRSSMNDMVASLRNLQLGKVKSMPSNRNIIPMGSPGFGSPRVSLLRAGFLSLPSTPTQVPGRGSVSHFDQWDQNRGEEPVMERVESGKGIRAKMFEKLSKENSLDGSGQVSDGAPDVDWVSQLLE*
• ORF Type: complete

Annotations of Ll_transcript_282677

• Blastp: Zinc finger CCCH domain-containing protein 49 from Arabidopsis with 60.18% of identity
• Blastx: Zinc finger CCCH domain-containing protein 20 from Arabidopsis with 55.7% of identity
• Eggnog: zinc finger CCCH domain-containing protein(ENOG410XR0Z)
• Kegg: Link to kegg annotations (AT4G29190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436217.1)
• Pfam: RNA-binding, Nab2-type zinc finger (PF14608.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;