Protein coding transcript 209035

• Transcript: Ll_transcript_72902
• CDS coordinates: 256-1287 (+)
• Peptide sequence: MVIGATLQHRFLLHFRPIMSQWSSIRTMSSLQNLEQAVKAEIEAKNYVKIPELLDSLESCQNSSNPFSFFSSFPQNLQVQIIDEMLQSFMPIRPRSKPKLAYSFLLSYTLQSSHPLPLSLAVLQRTIRSGCIPVPQTHVLLSSVWLNRRCQSHSVSNTLCEMHSIGYDPDCGTCNYLLSSLCAVDQLAEAVKVLKGMGGAGCIPDFTSYGIVIGALCRVRKTTEAEDLVKTMVVKYGLTPGQGTLVKLFAALRANREIWKAVEVIEFLEKEGHSVGFESYELVIEGCLEKREYVLAGKVAVRMTERGFIPYIKVRQKIIDGLASIGEWEIACSVRQRFAALKS*
• ORF Type: complete

Annotations of Ll_transcript_72902

• Blastp: Pentatricopeptide repeat-containing protein At1g06270 from Arabidopsis with 60.06% of identity
• Blastx: Pentatricopeptide repeat-containing protein At1g06270 from Arabidopsis with 59.87% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT1G06270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443349.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;