Protein coding transcript 209069

• Transcript: Ll_transcript_73457
• CDS coordinates: 191-655 (+)
• Peptide sequence: MDLECGNYLSSHAKSAVLQKKVPISEIDRALHNLFSIRIRLGLFNGNPTKLSFGMIGPNHVCSKKHQYLALEAARSGIVLLKNSDALLPLPKTNPAISLAVIGPNANDFTTLAGNYAGPPCRNMTVLQGLHHYVKNTVFHPGCDGGPKCPTAQIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_73457

• Blastp: Probable beta-D-xylosidase 7 from Arabidopsis with 61.94% of identity
• Blastx: Probable beta-D-xylosidase 7 from Arabidopsis with 62.42% of identity
• Eggnog: hydrolase family 3(COG1472)
• Kegg: Link to kegg annotations (AT1G78060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417349.1)
• Pfam: Glycosyl hydrolase family 3 C-terminal domain (PF01915.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;