Protein coding transcript 209073

• Transcript: Ll_transcript_73470
• CDS coordinates: 163-822 (+)
• Peptide sequence: MKAIGIEGRAIYNGGQAMGMTFWAPNINIFRDPRWGRGQETAGEDPLVTSTYAVSFVRGLQGDSFHGGKLMGHLQASACCKHFTAYDLDNWKGVSRFVFDARVSLQDLADTYQPPFKSCVKQGRASGIMCAYNRVNGVPSCADFNLLTKTAREKWDFNGYIASDCNAVAIIHDQQGYAKSPEDAVADVLRAGMVGPKPFVIFCSYALCDSHDNNHTLKS*
• ORF Type: complete

Annotations of Ll_transcript_73470

• Blastp: Probable beta-D-xylosidase 7 from Arabidopsis with 77.2% of identity
• Blastx: Probable beta-D-xylosidase 7 from Arabidopsis with 66.13% of identity
• Eggnog: hydrolase family 3(COG1472)
• Kegg: Link to kegg annotations (AT1G78060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417348.1)
• Pfam: Glycosyl hydrolase family 3 N terminal domain (PF00933.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;