Protein coding transcript 209130

• Transcript: Ll_transcript_72199
• CDS coordinates: 168-638 (+)
• Peptide sequence: MAVNSTSMLYLLSCFSSFIIFMLSFSHVQSHTLKYCDKNANYVVKVSGVEILPNPVVRGEPFTFKIAAFTGEPIQSGDLIYEISYAGFEAPPATFLHDLCEESSCPVPVGHFLLTHTELLPTYTPPMQLGCFICLLYSGFLVRLGLVFIFLDNHIL*
• ORF Type: complete

Annotations of Ll_transcript_72199

• Blastp: Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 from Dictyostelium with 31.73% of identity
• Blastx: Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 from Dictyostelium with 31.73% of identity
• Eggnog: phosphatidylglycerol phosphatidylinositol transfer protein(ENOG4111SSC)
• Kegg: Link to kegg annotations (DDB_G0282179)
• CantataDB: Link to cantataDB annotations (CNT0002594)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461778.1)
• Pfam: ML domain (PF02221.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;