Transcript | Ll_transcript_72608 |
---|---|
CDS coordinates | 168-707 (+) |
Peptide sequence | MALQPKKIIIDTDPGIDDAMAIFLALRSPEIEVIALTTIYGNVYTTLATRNALHLLEVAGRTDIPVVEGSHVTLTKGTKLRVADFVHGADGLGNQNFPPPKGKPLEESAAAYLVQQAKENPGKITVVALGPLTNIALAVQLDPEFYKNIGQIVILGGAFAVNGNVNPAAEANVSFSILN* |
ORF Type | complete |
Blastp | Probable uridine nucleosidase 2 from Arabidopsis with 81.55% of identity |
---|---|
Blastx | Probable uridine nucleosidase 2 from Arabidopsis with 69.66% of identity |
Eggnog | nucleoside hydrolase(COG1957) |
Kegg | Link to kegg annotations (AT1G05620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420711.1) |
Pfam | Inosine-uridine preferring nucleoside hydrolase (PF01156.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer