Protein coding transcript 209150

• Transcript: Ll_transcript_72608
• CDS coordinates: 168-707 (+)
• Peptide sequence: MALQPKKIIIDTDPGIDDAMAIFLALRSPEIEVIALTTIYGNVYTTLATRNALHLLEVAGRTDIPVVEGSHVTLTKGTKLRVADFVHGADGLGNQNFPPPKGKPLEESAAAYLVQQAKENPGKITVVALGPLTNIALAVQLDPEFYKNIGQIVILGGAFAVNGNVNPAAEANVSFSILN*
• ORF Type: complete

Annotations of Ll_transcript_72608

• Blastp: Probable uridine nucleosidase 2 from Arabidopsis with 81.55% of identity
• Blastx: Probable uridine nucleosidase 2 from Arabidopsis with 69.66% of identity
• Eggnog: nucleoside hydrolase(COG1957)
• Kegg: Link to kegg annotations (AT1G05620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420711.1)
• Pfam: Inosine-uridine preferring nucleoside hydrolase (PF01156.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;