Protein coding transcript 20917

• Transcript: Ll_transcript_283079
• CDS coordinates: 2-616 (+)
• Peptide sequence: YLSLYPSIYGFFSHTKRVEFIHLHHILNLKNTTQPLSSMHTKMGCMVFLRYSSFLFIHVFFSIFSFCFSEAQVVPAVYMFGDSLVDVGNNNYLPLSIAKANHRHYGIDFPNQTPTGRFSNGNNAADFIGKLIHSYYSFNILNIIFFIINLLINKYFFLHSLIYFHVICMLCIIFGDEDHLFQSMSSTVYQANQNEEKINKNMNV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_283079

• Blastp: GDSL esterase/lipase At5g55050 from Arabidopsis with 68.42% of identity
• Blastx: GDSL esterase/lipase At5g55050 from Arabidopsis with 68.42% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT5G55050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435609.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;