Transcript | Ll_transcript_70940 |
---|---|
CDS coordinates | 1-372 (+) |
Peptide sequence | SYCHYYRRGDLGLESNRLIVCGSCKVAVHRKCYGVLGDVDDESWLCSWCERKDEISETANPCVLCPNKGGALRPVTRYVEGVESVQFVHLLFCCLWTPGVYVDDLRRWSLLQMWMESRKAGEN* |
ORF Type | 5prime_partial |
Blastp | Histone-lysine N-methyltransferase ATX3 from Arabidopsis with 47.83% of identity |
---|---|
Blastx | Histone-lysine N-methyltransferase ATX3 from Arabidopsis with 43.68% of identity |
Eggnog | Histone-lysine N-methyltransferase(COG2940) |
Kegg | Link to kegg annotations (AT3G61740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430720.1) |
Pfam | PHD-finger (PF13831.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer