Protein coding transcript 2092

• Transcript: Ll_transcript_324821
• CDS coordinates: 1-369 (+)
• Peptide sequence: ILLSATMPSDVLEVTSCFMRKPIRILVKKEELTLEGIKQFFINVEKEDWKMDTLCDLYDTLSITQAVIFCNTRRKVDWLTENMHKRDFTVSAMHGDMEQRERDVIMRQFRTGSSRVLITTDLL
• ORF Type: internal

Annotations of Ll_transcript_324821

• Blastp: Eukaryotic initiation factor 4A-I from Pongo with 85.37% of identity
• Blastx: Eukaryotic initiation factor 4A-I from Pongo with 85.37% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (100173783)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015935196.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;