Transcript | Ll_transcript_324821 |
---|---|
CDS coordinates | 1-369 (+) |
Peptide sequence | ILLSATMPSDVLEVTSCFMRKPIRILVKKEELTLEGIKQFFINVEKEDWKMDTLCDLYDTLSITQAVIFCNTRRKVDWLTENMHKRDFTVSAMHGDMEQRERDVIMRQFRTGSSRVLITTDLL |
ORF Type | internal |
Blastp | Eukaryotic initiation factor 4A-I from Pongo with 85.37% of identity |
---|---|
Blastx | Eukaryotic initiation factor 4A-I from Pongo with 85.37% of identity |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (100173783) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015935196.1) |
Pfam | Helicase conserved C-terminal domain (PF00271.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer