Protein coding transcript 209200

• Transcript: Ll_transcript_70929
• CDS coordinates: 1-372 (+)
• Peptide sequence: SYCHYYRRGDLGLESNRLIVCGSCKVAVHRKCYGVLGDVDDESWLCSWCERKDEISETANPCVLCPNKGGALRPVTRYVEGVESVQFVHLLFCCLWTPGVYVDDLRRWSLLQMWMESRKAGEN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_70929

• Blastp: Histone-lysine N-methyltransferase ATX3 from Arabidopsis with 47.83% of identity
• Blastx: Protein Jade-1 from Danio with 37.36% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT3G61740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430720.1)
• Pfam: PHD-finger (PF13831.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;