Protein coding transcript 209206

• Transcript: Ll_transcript_70930
• CDS coordinates: 1353-2234 (+)
• Peptide sequence: MQQENLVKLDTLSGRTGVSSQPLPRAKETLSRVAVTRTSSEKYSDFGLSISNFSKEQPKLCDICGRSETMLNPVLLCSGCKVAVHLDCYRSVKDTMGPWYCELCESLSSRSSATSTINSREKPYFVAECALCGGTTGAFRRSCDGQWVHAFCAEWVFESTFRRGQINAVEGVETLLKGTDICCICCCKHGVCMKCCYGHCRTTFHPYCARSVGLYMNVRTTGGKLQHKAYCQRHSLEQKEKAETQKHGIGEFKRMKQIRVRLPFPSFYPGVLSHFFVRLDVLLMALLYLLICD*
• ORF Type: complete

Annotations of Ll_transcript_70930

• Blastp: NuA3 HAT complex component NTO1 from Saccharomyces with 30.94% of identity
• Blastx: Peregrin from Homo with 28.24% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YPR031W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416931.1)
• Pfam: PHD-finger (PF00628.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;