Protein coding transcript 209291

• Transcript: Ll_transcript_71942
• CDS coordinates: 3-509 (+)
• Peptide sequence: WLSFRLDVLSTITFAFCLVFLISIPNSITVPGEQSKLYKFTTHTLLVMTPNRKFIPFLHQFYFCQGIAGLAVTYALNLNAIQFSLVWNLCNLENKIISVERIFQYTSIPSEPPLVIKDSRPDRSWPSFGEIHIHDLQVLFNSNSFVSLRSECYNYIVESPRFLYSMYS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_71942

• Blastp: ABC transporter C family member 3 from Arabidopsis with 48% of identity
• Blastx: ABC transporter C family member 3 from Arabidopsis with 50% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT3G13080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020203571.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;