Transcript | Ll_transcript_324800 |
---|---|
CDS coordinates | 85-852 (+) |
Peptide sequence | MASIFSLNMISSLRLSNPSSISTSQIQNQVGSTFFQSFSTKSLNFSTTHQISTSKRSSSNTKTTAFFFNNKPKQHQDSSNPTKVQELSVYEINERDRNSPAYLRLSEKPENSLGDLVPFSNKLYSGDLEKRLGITAGLCVLIQHVPEKKGDRYEATYSFYFGNYGHISVQGPYLTYQDTYLAVTGGSGIFEGVYGQVKLQQIVFPFKLFYTFYLKGIHDLPTELLGKPIEPSPHVEPSLAAKASHPNASLLNFTN* |
ORF Type | complete |
Blastp | Allene oxide cyclase, chloroplastic from Oryza sativa with 73.96% of identity |
---|---|
Blastx | Allene oxide cyclase, chloroplastic from Oryza sativa with 73.96% of identity |
Eggnog | allene oxide cyclase(ENOG4111X07) |
Kegg | Link to kegg annotations (4333201) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459371.1) |
Pfam | Allene oxide cyclase (PF06351.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer