Protein coding transcript 209368

• Transcript: Ll_transcript_225907
• CDS coordinates: 234-719 (+)
• Peptide sequence: MDRYQKVDKPKPDSPINHNEIRITTQGAIRNYITYATSLLQEKNEAEIVLKAMGQAISKTVAIAEILKKRIPQLHQDTAISSISITDVWEPIEEGLVPVEMTRHVSLISITLSTSELNKDAPGYQAPNDVEQLKPNFNYQRQSIKPDRGPYNAVNEGNREH*
• ORF Type: complete

Annotations of Ll_transcript_225907

• Blastp: Ribonuclease P protein subunit p25-like protein from Homo with 32.12% of identity
• Blastx: Ribonuclease P protein subunit p25-like protein from Homo with 32.12% of identity
• Eggnog: ribonuclease P MRP 25kDa(ENOG4111WGZ)
• Kegg: Link to kegg annotations (138716)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414041.1)
• Pfam: Alba (PF01918.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;