| Transcript | Ll_transcript_226125 |
|---|---|
| CDS coordinates | 2415-2765 (+) |
| Peptide sequence | MVTQLRGEAQKLKDSNMSLQEKITELKAEKNELRDEKQRLKAEKEKLEQQVKSMNAQPGFMHHTPPVIPAAFAPQSQAPGNKLVPFMGYPGVAMWQFMPPAAVDTSQDHVLRPPVA* |
| ORF Type | complete |
| Blastp | Transcription factor ILR3 from Arabidopsis with 79.66% of identity |
|---|---|
| Blastx | Transcription factor ILR3 from Arabidopsis with 80.13% of identity |
| Eggnog | Transcription factor(ENOG4111M4Q) |
| Kegg | Link to kegg annotations (AT5G54680) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458841.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer