Transcript | Ll_transcript_227208 |
---|---|
CDS coordinates | 184-666 (+) |
Peptide sequence | MSSSSMDAFPAIQEIMLEFRAGKMHFEGKTVVPDPRRGLVRIARGEEGLVHFQWLDRTQNVVEDDQIIFPGEAVFEKVNQASGRVYILKFNSDDRKFFFWMQEPDSESDSQLCSSVNDYLNRQIEVLGDEEPDGSLPLQVSEDMAEDDISSRYMYFDIQI* |
ORF Type | complete |
Blastp | 26S proteasome regulatory subunit RPN13 from Arabidopsis with 69.13% of identity |
---|---|
Blastx | 26S proteasome regulatory subunit RPN13 from Arabidopsis with 69.18% of identity |
Eggnog | Adhesion regulating molecule(ENOG410XSJJ) |
Kegg | Link to kegg annotations (AT2G26590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446461.1) |
Pfam | Proteasome complex subunit Rpn13 ubiquitin receptor (PF04683.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer