Protein coding transcript 209572

• Transcript: Ll_transcript_227190
• CDS coordinates: 937-1407 (+)
• Peptide sequence: MCWDFVVGGKRAANLIVPNLGVEATSDVASSSGPVKLEDLQRILSNIGGPADNIVDPDGGFGLGDILKPDLIMPLMESLPLEQQLAPYLPEGKWSPEEILELLQSPPFRQQVDSFTYVRMQCLCFFTFLSFHFKRHCKCVYLLIYCCRYLKQDRLI*
• ORF Type: complete

Annotations of Ll_transcript_227190

• Blastp: 26S proteasome regulatory subunit RPN13 from Arabidopsis with 66.97% of identity
• Blastx: 26S proteasome regulatory subunit RPN13 from Arabidopsis with 66.97% of identity
• Eggnog: Adhesion regulating molecule(ENOG410XSJJ)
• Kegg: Link to kegg annotations (AT2G26590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446461.1)
• Pfam: UCH-binding domain (PF16550.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;