Protein coding transcript 209574

• Transcript: Ll_transcript_227192
• CDS coordinates: 3-473 (+)
• Peptide sequence: YRGRMSSSSMDAFPAIQDILLEFRAGRMFLEGKTVVPDPRKGLFRVATGEEGLVHFQWLDRTQNVVEDDQIIFPGEAVFEKVNQASGRVYILKFNSDDRKFFFWMQEPDSESDSQLCSSVNDYLNRQIEVLGDEEPDGSLPLQVSEDMAEDDISSR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_227192

• Blastp: 26S proteasome regulatory subunit RPN13 from Arabidopsis with 66.44% of identity
• Blastx: 26S proteasome regulatory subunit RPN13 from Arabidopsis with 59.77% of identity
• Eggnog: Adhesion regulating molecule(ENOG410XSJJ)
• Kegg: Link to kegg annotations (AT2G26590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422183.1)
• Pfam: Proteasome complex subunit Rpn13 ubiquitin receptor (PF04683.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;