Protein coding transcript 209646

• Transcript: Ll_transcript_227302
• CDS coordinates: 2-538 (-)
• Peptide sequence: ILKFFNINSSIAAPPSIKEIIWQHPSVGWVKINSDGVAKGFPGHSGGGFICRDDKGNVLHCMASYFGIKDALYAEIKTDVLAIDLASNKGWNAVWLELDSAITVDLFNGKGEVPWMLLKDWRRCSTLLNTINYKVTHIYREGNQCADRLANYAINSKLSHAWDYAPSFILEPLNRNRLS
• ORF Type: internal

Annotations of Ll_transcript_227302

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 31.43% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 31.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427114.1)
• Pfam: Reverse transcriptase-like (PF13456.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;