| Transcript | Ll_transcript_225968 |
|---|---|
| CDS coordinates | 431-904 (+) |
| Peptide sequence | MQMSLVAARKSLASENGNVQPPIHGVTFPCYYDSEDATSMGSRTTGVSTPMKFMSGLCTSDGGRQGNGTLTTVSNLMKEFEQRRHNFDDEMKVLNEVKPAQQSANMNNLQQLLKLKHRFEGWKKQYKVRLQETKARLHKSEVGKSRRTWWEKVSSRA* |
| ORF Type | complete |
| Blastp | Myosin-2 from Arabidopsis with 45.34% of identity |
|---|---|
| Blastx | Myosin-2 from Arabidopsis with 44.44% of identity |
| Eggnog | myosin heavy chain(COG5022) |
| Kegg | Link to kegg annotations (AT5G54280) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435284.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer