Protein coding transcript 209730

• Transcript: Ll_transcript_227022
• CDS coordinates: 86-463 (+)
• Peptide sequence: MKKASSLMEAKAKGNEKKKIITPCCNKVGLKRGPWTREEDEVLSNFIKKEGEGRWRTLPKRAGLLRCGKSCRLRWINYLRPSLKHGHIAPDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_227022

• Blastp: Transcription repressor MYB5 from Arabidopsis with 85.19% of identity
• Blastx: Transcription repressor MYB5 from Arabidopsis with 85.19% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G13540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430626.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;