Transcript | Ll_transcript_226808 |
---|---|
CDS coordinates | 569-964 (+) |
Peptide sequence | MICSLKCPISSPSSWSGESSDNISPDGHKIHGSREHGYSILKNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVATVDQSQPGGKGDEETILLQFGKVGDDTFTMDYMKPLSPFQAFAICLSSFGTKLACE* |
ORF Type | complete |
Blastp | Tubby-like F-box protein 7 from Arabidopsis with 74.81% of identity |
---|---|
Blastx | Tubby-like F-box protein 7 from Arabidopsis with 76% of identity |
Eggnog | tubby like protein(ENOG410XQFT) |
Kegg | Link to kegg annotations (AT1G53320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456642.1) |
Pfam | Tub family (PF01167.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer