Protein coding transcript 209770

• Transcript: Ll_transcript_226809
• CDS coordinates: 1418-1813 (+)
• Peptide sequence: MICSLKCPISSPSSWSGESSDNISPDGHKIHGSREHGYSILKNKAPRWHEHLQCWCLNFHGRVTVASVKNFQLVATVDQSQPGGKGDEETILLQFGKVGDDTFTMDYMKPLSPFQAFAICLSSFGTKLACE*
• ORF Type: complete

Annotations of Ll_transcript_226809

• Blastp: Tubby-like F-box protein 7 from Arabidopsis with 74.81% of identity
• Blastx: Tubby-like F-box protein 7 from Arabidopsis with 78.33% of identity
• Eggnog: tubby like protein(ENOG410XQFT)
• Kegg: Link to kegg annotations (AT1G53320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456642.1)
• Pfam: Tub family (PF01167.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;