Protein coding transcript 209850

• Transcript: Ll_transcript_225435
• CDS coordinates: 4031-4951 (+)
• Peptide sequence: MQLAIVGRPNVGKSTLLNSLLKEDRVLVGPEAGLTRDSIRTQFEYQGRTIYLVDTAGWLQRTKQDKGAASLSVMQSRKSLLRANIIALVLDAEEIVNAKRSMKHAEVVIARRAVEEGRGLVVVVNKMDLLRGKNKSLSYEKVMEIVPQEIQTVIPQITGIPVVFTSALEGRGRTAVLNQVVDTYEKWCTRLPTSRLNRWLKKVMSRHSWKDLAAQPKIKYFTQVKARPPTFVAFMSGKTQLSDTDIRFLTKSLKDDFDLGGIPIRIMQRSITKKEARSSSSKSNHSVSASRVAERVMSDKRKVIVE*
• ORF Type: complete

Annotations of Ll_transcript_225435

• Blastp: GTPase Der from Magnetospirillum with 41.91% of identity
• Blastx: Calreticulin-3 from Arabidopsis with 85.28% of identity
• Eggnog: GTPase that plays an essential role in the late steps of ribosome biogenesis (By similarity)(COG1160)
• Kegg: Link to kegg annotations (amb1344)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420019.1)
• Pfam: Ferrous iron transport protein B (PF02421.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;