Protein coding transcript 209853

• Transcript: Ll_transcript_225438
• CDS coordinates: 521-985 (+)
• Peptide sequence: MFGPDLCRSQTKKLHVILSYQGQNYPIRKDLQCETDKLTHFYTFILRPDATYSVPVDNRERDSGSMYIDWDILPPKKIKDVNAKKPIDWDDREYIEDPNDAKPEGYDSIPAEIPDPKVKEPVDWDEEEDGLESPRKFLIQHTKDHGSARFFKLQI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_225438

• Blastp: Calreticulin-3 from Arabidopsis with 80.15% of identity
• Blastx: Calreticulin-3 from Arabidopsis with 82.18% of identity
• Eggnog: Calreticulin(ENOG410XRR7)
• Kegg: Link to kegg annotations (AT1G08450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454141.1)
• Pfam: Calreticulin family (PF00262.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;