Protein coding transcript 209866

• Transcript: Ll_transcript_225453
• CDS coordinates: 322-903 (+)
• Peptide sequence: MYNYAFGLISLLNKNKFICFMGMKSMPSCLYCNVALNFGNFKQITGIPVVFTSALEGRGRTAVLNQVVDTYEKWCTRLPTSRLNRWLKKVMSRHSWKDLAAQPKIKYFTQVKARPPTFVAFMSGKTQLSDTDIRFLTKSLKDDFDLGGIPIRIMQRSITKKEARSSSSKSNHSVSASRVAERVMSDKRKVIVE*
• ORF Type: complete

Annotations of Ll_transcript_225453

• Blastp: GTPase Der from Magnetospirillum with 42.5% of identity
• Blastx: GTPase Der from Magnetospirillum with 42.5% of identity
• Eggnog: GTPase that plays an essential role in the late steps of ribosome biogenesis (By similarity)(COG1160)
• Kegg: Link to kegg annotations (amb1344)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020230762.1)
• Pfam: KH-domain-like of EngA bacterial GTPase enzymes, C-terminal (PF14714.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;