Protein coding transcript 209930

• Transcript: Ll_transcript_225332
• CDS coordinates: 265-795 (+)
• Peptide sequence: MASADVEFRCFVGGLAWATDSEALEKAFSQYGEILDSKIINDRETGRSRGFGFVTFASEQSMKDAIEGLNGQDLDGRNITVNEAQSRGSGGGGGRGGGGYGGGGGGFRSGGGGGYGGGRREGGGGGYNRNGGGGGYGGGGGGGGYGGGRDRGYGGGGDGGSRYSRDGESGGGGWRN*
• ORF Type: complete

Annotations of Ll_transcript_225332

• Blastp: Glycine-rich RNA-binding protein GRP1A from Sinapis with 87.06% of identity
• Blastx: Glycine-rich RNA-binding protein GRP1A from Sinapis with 87.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000217)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454173.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;