Protein coding transcript 209931

• Transcript: Ll_transcript_225341
• CDS coordinates: 106-453 (+)
• Peptide sequence: MKDAIEGLNGQDLDGRNITVNEAQSRGSGGGGGRGGGGYGGGGGGFRSGGGGGYGGGRREGGGGGYNRNGGGGGYGGGGGGGGYGGGRDRGYGGGGDGGSRYSRDGESGGGGWRN*
• ORF Type: complete

Annotations of Ll_transcript_225341

• Blastp: Glycine-rich RNA-binding protein blt801 from Hordeum with 82.14% of identity
• Blastx: Glycine-rich RNA-binding protein GRP1A from Sinapis with 87.5% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000219)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454174.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;