Protein coding transcript 20994

• Transcript: Ll_transcript_283023
• CDS coordinates: 2-526 (+)
• Peptide sequence: AKPYKMSKARDSPTHSESKSTATTTRTASWLLAPFLLPVLVAALFYRFDPFDPVHFPPNVLNRFTFIAPARNNRMRVGSEVMAEGHVAGPEDFVYDASARVLYTGCEDGWIKRVTVNDSVADSVVENWVNTGGRPLGLAFGPNGELIVGDADKLRYSNCRVIPKHNVAAASAAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_283023

• Blastp: Protein STRICTOSIDINE SYNTHASE-LIKE 4 from Arabidopsis with 45.6% of identity
• Blastx: Protein STRICTOSIDINE SYNTHASE-LIKE 4 from Arabidopsis with 49.54% of identity
• Eggnog: SMP-30 gluconolaconase LRE domain protein(COG3386)
• Kegg: Link to kegg annotations (AT3G51420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423894.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;