Transcript | Ll_transcript_283024 |
---|---|
CDS coordinates | 382-1134 (+) |
Peptide sequence | MVCEHSNNPLMVQGLLRVTMDKKVEVLVDEVDGLKFKLTDGVDVAHDGTIYFTDASCKYHIKDSVIDILEGKPNGRFMSYNPTTKKTTLLADKLYFPNGVAVSPNQNFVVFCETSLMRCRKYYIQGPKTGSIEKFCDLPGMPDNIHYDGHGQYWIGIATEFTPQLEFMFRYPFVRKAAVMLTKYVGILTKTTNGGVLAVDLEGKPTSHYYDPDLSLTSGIKIGNHLYCGSIIYHFVIRLDVKQYPALPAT* |
ORF Type | complete |
Blastp | Protein STRICTOSIDINE SYNTHASE-LIKE 5 from Arabidopsis with 50.21% of identity |
---|---|
Blastx | Protein STRICTOSIDINE SYNTHASE-LIKE 5 from Arabidopsis with 50.7% of identity |
Eggnog | SMP-30 gluconolaconase LRE domain protein(COG3386) |
Kegg | Link to kegg annotations (AT3G51430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423894.1) |
Pfam | SMP-30/Gluconolaconase/LRE-like region (PF08450.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer