| Transcript | Ll_transcript_283026 |
|---|---|
| CDS coordinates | 2-505 (+) |
| Peptide sequence | AKPYKMSKARDSPTHSESKSTATTTRTASWLLAPFLLPVLVAALFYRFDPFDPVHFPPNVLNRFTFIAPARNNRMRVGSEVMAEGHVAGPEDFVYDASARVLYTGCEDGWIKRVTVNDSVADSVVENWVNTGGRPLGLAFGPNGELIVGDADKVRHRLIFCELYFRVE |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Protein STRICTOSIDINE SYNTHASE-LIKE 4 from Arabidopsis with 49.54% of identity |
| Eggnog | SMP-30 gluconolaconase LRE domain protein(COG3386) |
| Kegg | Link to kegg annotations (AT3G51420) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423894.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer