Protein coding transcript 210015

• Transcript: Ll_transcript_226987
• CDS coordinates: 808-1359 (-)
• Peptide sequence: MSNHMQNSSTHGSSSSSQAPSDQQQQHHQQPQPLSRYESQKKRDWNTFGQYLNNQSPPVPLSQCNFNHVIEFLRYLDQFGKTKVHLQSCIFFGQPAPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGLPETNPFGSGAIRIHLREVKECQGKARGIPYKKKKKKRNQIKESQSAKAFKQLAS*
• ORF Type: complete

Annotations of Ll_transcript_226987

• Blastp: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 from Arabidopsis with 72.11% of identity
• Blastx: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 from Arabidopsis with 81.45% of identity
• Eggnog: light sensitive hypocotyls 10(ENOG41119V3)
• Kegg: Link to kegg annotations (AT2G42610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444945.1)
• Pfam: Protein of unknown function (DUF640) (PF04852.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;