Transcript | Ll_transcript_225923 |
---|---|
CDS coordinates | 1193-1570 (+) |
Peptide sequence | MKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSDTVEEADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSSQEYSSNTDHGYILFYESIANRN* |
ORF Type | complete |
Blastp | Ubiquitin carboxyl-terminal hydrolase 3 from Arabidopsis with 94.31% of identity |
---|---|
Blastx | Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 86.33% of identity |
Eggnog | ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81) |
Kegg | Link to kegg annotations (AT4G39910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416530.1) |
Pfam | Ubiquitin carboxyl-terminal hydrolase (PF00443.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer