Protein coding transcript 210033

• Transcript: Ll_transcript_225925
• CDS coordinates: 1193-1570 (+)
• Peptide sequence: MKIKKPPRILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSDTVEEADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSSQEYSSNTDHGYILFYESISNKN*
• ORF Type: complete

Annotations of Ll_transcript_225925

• Blastp: Ubiquitin carboxyl-terminal hydrolase 3 from Arabidopsis with 94.26% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 85.55% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81)
• Kegg: Link to kegg annotations (AT4G39910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414347.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;