Protein coding transcript 210055

• Transcript: Ll_transcript_226715
• CDS coordinates: 1-723 (+)
• Peptide sequence: RKHGEKKWKCDKCSKRYAVQSDWKAHSKTCGTREYKCDCGTIFSRRDSFITHRAFCDALAEETARVNATSNISNSLGPNFSYNIMGTPQVPNMATHFSSIFVPISSTGHETSTHTTRGLSLWMDELSHQAHETMVNGNFHQLGSATSSGSAIYDVNNNPLVQYSNNPPPSNNYRPNWILGTKPSSNSSQELITSTTSSLPLVNIIKDATCTNQLISVPSLYSSQHQSHQTSSATNMSATAL
• ORF Type: internal

Annotations of Ll_transcript_226715

• Blastp: Zinc finger protein MAGPIE from Arabidopsis with 42.8% of identity
• Blastx: Zinc finger protein MAGPIE from Arabidopsis with 78.02% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT1G03840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464968.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;