Protein coding transcript 210078

• Transcript: Ll_transcript_225684
• CDS coordinates: 35-799 (+)
• Peptide sequence: MAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPLFELVWTAQTIAPDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIEKALTEAFNPLNIKDYNSLFWIAHPGGPAILDQVEAKLALKPEKMRATRHILSEYGNMSSAC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_225684

• Blastp: Chalcone synthase 2 from Trifolium with 94.12% of identity
• Blastx: Chalcone synthase 6 from Trifolium with 93.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420991.1)
• Pfam: Chalcone and stilbene synthases, N-terminal domain (PF00195.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;