Transcript | Ll_transcript_225694 |
---|---|
CDS coordinates | 1-789 (+) |
Peptide sequence | IFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFELVWTAQTIAPDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALVEAFNPLNISDYNSIFWIAHPGGPAILDQVEAKLALKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGLEWGVLFGFGPGLTIETVVLHSVAT* |
ORF Type | 5prime_partial |
Blastp | Chalcone synthase 1 from Cicer with 95.79% of identity |
---|---|
Blastx | Chalcone synthase 1 from Cicer with 95.79% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444595.1) |
Pfam | Chalcone and stilbene synthases, N-terminal domain (PF00195.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer