Transcript | Ll_transcript_225690 |
---|---|
CDS coordinates | 1-408 (+) |
Peptide sequence | VPRLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDRPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPLF |
ORF Type | internal |
Blastp | Chalcone synthase 4 from Trifolium with 97.06% of identity |
---|---|
Blastx | Chalcone synthase 4 from Trifolium with 97.06% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420992.1) |
Pfam | Chalcone and stilbene synthases, N-terminal domain (PF00195.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer