Protein coding transcript 210089

• Transcript: Ll_transcript_225690
• CDS coordinates: 1-408 (+)
• Peptide sequence: VPRLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDRPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPLF
• ORF Type: internal

Annotations of Ll_transcript_225690

• Blastp: Chalcone synthase 4 from Trifolium with 97.06% of identity
• Blastx: Chalcone synthase 4 from Trifolium with 97.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420992.1)
• Pfam: Chalcone and stilbene synthases, N-terminal domain (PF00195.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;