| Transcript | Ll_transcript_225692 |
|---|---|
| CDS coordinates | 3-413 (+) |
| Peptide sequence | IDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGPAILDQVELKLGLKPEKMRATRHVLSEYGNMSSACVLFIMDEMRKKSAQDGLKTTGEGLEWGVLFGFGPGLTVETVVLHSVVA* |
| ORF Type | 5prime_partial |
| Blastp | Chalcone synthase 1 from Camellia with 93.28% of identity |
|---|---|
| Blastx | Chalcone synthase 1 from Camellia with 93.28% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454331.1) |
| Pfam | Chalcone and stilbene synthases, C-terminal domain (PF02797.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer