Protein coding transcript 2101

• Transcript: Ll_transcript_324863
• CDS coordinates: 3-470 (+)
• Peptide sequence: SSSQTSMQMPFQWMKLSSRETWNLLLPFFLGFLLILKISLHLIQIMNTNHPRSEPTKHRNNALTDAKDPALQNLTSAAKSQIKNVTSVNEFLITEVPSFLDLENKGASMLLKDDKVNEIFREYPYLFASVGELTVDDVEDLLNNYKELVFKYVCLS
• ORF Type: internal

Annotations of Ll_transcript_324863

• Blastp: Vacuolar protein sorting-associated protein 9A from Arabidopsis with 43.33% of identity
• Blastx: Vacuolar protein sorting-associated protein 9A from Arabidopsis with 43.33% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YGAZ)
• Kegg: Link to kegg annotations (AT3G19770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415562.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;