| Transcript | Ll_transcript_226187 |
|---|---|
| CDS coordinates | 1173-1589 (+) |
| Peptide sequence | MNLVESNEAFFVCADDDFKDLVDELPRGVRLTIVSDSCHSGGLLKETKEQIGDSTKGAEDQDSGSGLSNFLHQKLENAFNSRGIHVPSALQHHRRIKHDEVEDRDTYLPHGQHHHVKNKSLPLSTLIDILKQKTGKDDI |
| ORF Type | 3prime_partial |
| Blastp | Metacaspase-4 from Arabidopsis with 49.24% of identity |
|---|---|
| Blastx | Metacaspase-4 from Arabidopsis with 73.91% of identity |
| Eggnog | Metacaspase(ENOG410Y41C) |
| Kegg | Link to kegg annotations (AT1G79340) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449305.1) |
| Pfam | Caspase domain (PF00656.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer